IGF-1 Long R3 1mg

£49.00

Product Overview

Technical Parameter Specification
Product Name IGF-1 Long R3 1mg (Long Arginine 3-IGF-1 / LR3-IGF-1)
Molecular Sequence MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Molecular Weight ~9,117.5 g/mol
CAS Registry Number 946870-92-4
Purity Standard ≥98.0% (Verified via HPLC & Mass Spectrometry)
Physical Form Lyophilised Powder (Vacuum-Sealed Glass Vial)
Recommended Storage 2°C – 8°C (Short Term) / -20°C (Long Term)
Reconstitution Reagent Bacteriostatic Water (0.9% Benzyl Alcohol) or Sterile Water
Domestic Fulfillment 100% UK Warehouse Inventory
SKU: IGF1_LR3-1mg Category: Tags: , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , ,

Description

Buy IGF-1 Long R3 1mg UK

For laboratories and research institutions conducting advanced investigations into growth factor signalling, receptor binding dynamics, and cellular proliferation pathways, our IGF-1 Long R3 1mg delivers verified ≥98% HPLC purity with full mass spectrometry confirmation . This synthetic analogue of human insulin-like growth factor-1 incorporates an arginine substitution at position 3 (R3) and an N-terminal extension, modifications that reduce affinity for endogenous IGF-binding proteins while maintaining potent IGF-1 receptor interaction characteristics . Manufactured under stringent controlled conditions and vacuum-sealed in lyophilised form, every batch is preserved through our temperature-monitored cold-chain from UK warehouse to your laboratory bench. With 100% domestic UK stockholding and same-day dispatch on orders placed before 2:00 PM GMT, we eliminate customs delays and temperature excursions that compromise research integrity .

Research Applications & Key Benefits

  • IGF-1 Receptor (IGF-1R) Signalling Studies: IGF-1 Long R3 functions as a potent molecular tool for investigating IGF-1R binding, activation kinetics, and downstream intracellular signalling cascades (including PI3K/AKT and MAPK/ERK pathways) . The R3 substitution reduces IGFBP affinity, enabling clearer receptor-specific signalling characterisation in vitro.

  • Growth Factor-Mediated Pathway Investigation: Used in cellular and biochemical research models examining proliferation, differentiation, and survival signalling pathways. Researchers commonly employ this analogue to study receptor binding behaviour, signalling kinetics, and comparative responses relative to native IGF-1 .

  • Serum-Free Cell Culture Applications: Developed originally for use in mammalian serum-free cell culture systems to promote cell growth, survival, and recombinant protein expression—making it a valuable research tool for cell biology and bioprocessing studies .

  • Comparative IGF Analogue Studies: Provides a well-characterised reference compound for studies comparing modified and native IGF-1 analogues, enabling investigation of how structural modifications influence receptor interaction, stability, and signalling profiles .

  • Preclinical Research Models: Extensively referenced in laboratory studies examining IGF-1R pathway pharmacology, cellular signalling mechanisms, and growth factor biology within controlled research systems .

The Pure Peptides UK Advantage

100% Domestic UK Stockholding
All inventory is warehoused within the United Kingdom, eliminating international shipping delays, customs clearance uncertainties, and extended transit times that compromise peptide stability .

Same-Day Dispatch Commitment
Orders confirmed before 2:00 PM GMT are dispatched the same working day via tracked courier services, ensuring minimal time between order placement and receipt.

Batch-Specific Certificates of Analysis
Each vial is traceable to its production batch, with full HPLC chromatograms, mass spectrometry data, and purity verification documentation available. This supports institutional procurement requirements and audit compliance .

Cold-Chain Integrity
Temperature-controlled storage at 2°C–8°C prior to dispatch, with insulated packaging designed to maintain lyophilised product stability during transit. Long-term storage recommended at -20°C for extended stability .

Discreet & Secure Delivery
Plain, unbranded outer packaging protects your research privacy. All shipments are fully tracked with delivery confirmation.

Dedicated UK Support
Our UK-based technical support team is available to assist with product queries, storage guidance, and reconstitution protocols. No dosing, administration, or clinical guidance is provided—we support your research objectives exclusively.

Regulatory Compliance & In-Vitro Disclaimer

FOR IN-VITRO RESEARCH & LABORATORY USE ONLY

This product is a research-grade chemical supplied exclusively for:

  • In-vitro laboratory experimentation

  • Analytical testing and method development

  • Biochemical assay and cellular model research

  • Scientific study and educational purposes

STRICTLY NOT FOR:

  • Human consumption, administration, or therapeutic application

  • Veterinary use or animal experimentation outside licensed laboratory settings

  • Diagnostic, treatment, or preventative medical purposes

  • Any application outside a controlled laboratory environment 

All users must comply with applicable UK and EU regulations governing the procurement, handling, and use of research chemicals. This product is not a medicinal product, dietary supplement, or foodstuff. No medical or therapeutic claims are made, expressed, or implied. Researchers are responsible for ensuring that their intended use complies with institutional ethics committees and relevant regulatory frameworks.

Additional information

Cap Colour

Blue