Follistatin 344 1mg 95% purity
£75.00
“`html
Product Overview
| Product Specifications | |
|---|---|
| Product Name | Follistatin 344 1mg (FST-344 / FS344) |
| Molecular Sequence | MVRARHQPGGLCLLLLLLCQFMEDRSAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW |
| Molecular Weight | 3,780.0 g/mol (free base basis) / ~31.5 kDa (recombinant) |
| CAS Registry Number | 80449-31-6 |
| Purity Standard | ≥98.0% (Verified via HPLC & Mass Spectrometry) |
| Physical Form | Lyophilised Powder (Vacuum-Sealed Glass Vial) |
| Recommended Storage | -20°C (Long Term) / Protected from Light & Moisture |
| Reconstitution Reagent | Sterile Water or Buffered Aqueous Solutions |
| Domestic Fulfillment | 100% UK Warehouse Inventory |
“`
Description
Buy Follistatin 344 1mg UK
For laboratories and research institutions investigating TGF-β superfamily signaling, myostatin inhibition, and tissue plasticity mechanisms, our Folli statin 344 1mg delivers verified ≥98% HPLC purity with comprehensive batch traceability. This recombinant protein corresponds to the full-length 344-amino-acid isoform of human Folli statin (FST)—the predominant isoform expressed in non-gonadal tissues—and functions as a potent endogenous antagonist of myostatin (GDF-8) and activins within the TGF-β signaling cascade. Manufactured under GMP-aligned processes, vacuum-sealed in lyophilized form, and preserved through our temperature-monitored cold-chain, every batch is accompanied by a Certificate of Analysis for complete experimental traceability. With 100% domestic UK stockholding and same-day dispatch on orders placed before 2:00 PM GMT, we eliminate customs delays and temperature excursions that compromise research integrity.
Research Applications & Key Benefits
-
TGF-β Superfamily Signalling Research: Follistatin 344 binds and neutralises multiple members of the transforming growth factor-beta (TGF-β) superfamily, including myostatin (GDF-8), activin A, activin B, BMP-2, BMP-4, and BMP-7, through a high-affinity wrapping mechanism that sterically blocks receptor engagement. This makes it a valuable molecular tool for investigating ligand-receptor interactions, SMAD-dependent transcriptional outputs, and downstream signaling cascades in diverse cellular models.
-
Myostatin Inhibition & Skeletal Muscle Research: Folli statin’s ability to neutralise myostatin—the primary negative regulator of skeletal muscle growth—has positioned it as a central focus in myogenic and regenerative studies . Research applications include investigating muscle fiber hypertrophy, satellite cell activity, myoblast proliferation and differentiation, and the molecular mechanisms underlying tissue plasticity.
-
Activin Sequestration & Endocrine Signalling Studies: Folli statin 344 modulates activin A and activin B signaling, influencing pituitary signaling loops, gonadotropin regulation, and broader endocrine feedback mechanisms. Research models explore its role in reproductive endocrinology, inflammatory signaling, and fibrotic processes.
-
Metabolic & Adipose Tissue Research: Emerging research has investigated follistatin’s effects on metabolic regulation, including lipid metabolism, insulin sensitivity, and adipose deposition . Studies in transgenic models have demonstrated correlations with altered fat content and metabolic transcription factor expression.
-
Tissue Regeneration & Fibrosis Research: Follistatin-344 is investigated for its potential roles in tissue repair, extracellular matrix remodelling, and the balance between regenerative and fibrotic transcriptional programs .
The Pure Peptides UK Advantage
100% Domestic UK Stockholding
All inventory is warehoused within the United Kingdom, eliminating international shipping delays, customs clearance uncertainties, and extended transit times. Your order ships from our UK facility directly to your laboratory.
Same-Day Dispatch Commitment
Orders confirmed before 2:00 PM GMT are dispatched the same working day via tracked courier services, ensuring minimal time between order placement and receipt.
Batch-Specific Certificates of Analysis
Each vial is traceable to its production batch, with full HPLC chromatograms and purity verification documentation available. Independent third-party testing confirms identity and purity standards.
Cold-Chain Integrity
Temperature-controlled storage at -20°C prior to dispatch, with insulated packaging designed to maintain lyophilised product stability during transit. Long-term storage recommended at -20°C or below, protected from light and moisture.
Discreet & Secure Delivery
Plain, unbranded outer packaging protects your research privacy. All shipments are fully tracked with delivery confirmation. No compound names appear on external packaging.
Dedicated UK Support
Our UK-based technical support team is available to assist with product queries, storage guidance, and reconstitution protocols. No dosing, administration, or clinical guidance is provided—we support your research objectives exclusively.
Regulatory Compliance & In-Vitro Disclaimer
FOR IN-VITRO RESEARCH & LABORATORY USE ONLY
This product is a research-grade recombinant protein supplied exclusively for:
-
In-vitro laboratory experimentation
-
Analytical testing and method development
-
Biochemical assay and cellular model research
-
Scientific study and educational purposes
STRICTLY NOT FOR:
-
Human consumption, administration, or therapeutic application
-
Veterinary use or animal experimentation outside licensed laboratory settings
-
Diagnostic, treatment, or preventative medical purposes
-
Any application outside a controlled laboratory environment
All users must comply with applicable UK and EU regulations governing the procurement, handling, and use of research chemicals. This product is not a medicinal product, dietary supplement, or foodstuff. No medical or therapeutic claims are made, expressed, or implied. Researchers are responsible for ensuring that their intended use complies with institutional ethics committees and relevant regulatory frameworks.
Additional information
| Cap Colour | Orange |
|---|










